SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000362 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000362
Domain Number 1 Region: 383-509
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-41
Family C-type lectin domain 0.000071
Further Details:      
 
Domain Number 2 Region: 42-173
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.07e-25
Family Cysteine rich domain 0.003
Further Details:      
 
Domain Number 3 Region: 695-815
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-21
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 4 Region: 173-231
Classification Level Classification E-value
Superfamily Kringle-like 2.43e-19
Family Fibronectin type II module 0.00089
Further Details:      
 
Domain Number 5 Region: 903-979
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000412
Family C-type lectin domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000362   Gene: ENSVPAG00000000387   Transcript: ENSVPAT00000000389
Sequence length 982
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_60:188:56192:1 gene:ENSVPAG00000000387 transcript:ENSVPAT00000000389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGRPAPAPWPRHLLRCVLLLGGLHLGRPRAAAAAAALPEPNVFLIFSHGLQGCLEAQG
GQVRVSPACNASLPAQRWKWVSRNRLFNLGTMQCLGTGWPGSNTTASLGMYECDREALSL
RWHCRTLGDQLSLLLGGRSGNTSKAGSPERGDQTRSGQWRIYGSDEDLCSRPYYEVYTIQ
GNSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWFFCPISGXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKMCLRGGGDL
LSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDS
LEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGTAEEDHGCRKXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVFSWERLQDKKNWVQAQGACQELGAQLLSLASY
EEEHFVANMLNKIFGESELEIHEQPWFGIGVNRRDPGAGKSWRWSDGLGFSYHNFDRSRH
DDDDIRGCAVLDLASLQWVALQCETQLDWICKIPRGADVREPDDSPQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXWTDGSVINFISWAPGKPRPIGKDKKCVYMMASREDWGDQRCLTALPYICKRSNSTRD
QQPPDPSPTGGCPSGWSQFLNK
Download sequence
Identical sequences ENSVPAP00000000362 ENSVPAP00000000362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]