SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000485 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000485
Domain Number 1 Region: 337-690
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.37e-147
Family Transferrin 0.00000000000322
Further Details:      
 
Domain Number 2 Region: 201-334
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.43e-39
Family Transferrin 0.000000573
Further Details:      
 
Domain Number 3 Region: 7-53
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000154
Family Transferrin 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000485   Gene: ENSVPAG00000000519   Transcript: ENSVPAT00000000521
Sequence length 691
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1116:166755:190701:-1 gene:ENSVPAG00000000519 transcript:ENSVPAT00000000521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLAASKKSVRWCTTSLAESSKCAQWQGNMKKVRVPVTCVKKTSRFECIQAISXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXCLQDGAGDVAFVKDSTVFESLPEKADRDQYELLCPNNTRK
PVDAFQECHLAVPSHAVVARSVNGKEXXXXXXXXXXXEKFGRGKPSAFQLFGSPAGQKDL
LFKDSALGLLRIPSKIDSGLYLGSNYITAIRGLRETAAEVELRRAQVVWCAVGSEEQLKC
QEWSRQSNQSVVCATASTTEDCIALVLKGEADALSLDGGYIYIAGKCGLVPVLAESQQSP
ESSGLDCVHRPVKGYLAVAVVRKANDKITWNSLRGKKSCHTAVDRTAGWNIPMGLLFKNT
DSCRFDEFFSQSCAPGSDPRSKLCALCAGNEAGQNKCVPNSSERYYGYTGAFRCLAENVG
DVAFVKDVTVLDNTDGKNTEQWAKDLKLGDFELLCLNGTRKPVTEAESCHLAMAPNHAVV
SRTDKVAHLEQVLLHQQAHFGRNGQDCPGKFCLFQSKTKNLLFNDNTECLAKLQGKTTYE
EYLGPQYVTAIAKLRRCSTSPLLEACAFLRR
Download sequence
Identical sequences ENSVPAP00000000485 ENSVPAP00000000485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]