SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000544 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000544
Domain Number 1 Region: 308-365
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.31e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000497
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000000544
Domain Number - Region: 268-314
Classification Level Classification E-value
Superfamily ARM repeat 0.00506
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000544   Gene: ENSVPAG00000000589   Transcript: ENSVPAT00000000588
Sequence length 365
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_89:3027002:3063892:-1 gene:ENSVPAG00000000589 transcript:ENSVPAT00000000588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQV
QQQHQPQQQQHHHHQHQQAQPQQTVPPQAQAQQVLIPASQQAAAPQVIVPDSKLIQHMNA
SNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQ
MQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFAGNKTQVIPTTVAAPTPAQAQIT
AAGQQQPQAQPAQQQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEE
EPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAI
GDAEW
Download sequence
Identical sequences ENSVPAP00000000544 ENSVPAP00000000544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]