SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000549 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000549
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.64e-19
Family Single strand DNA-binding domain, SSB 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000549   Gene: ENSVPAG00000000593   Transcript: ENSVPAT00000000593
Sequence length 167
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1254:427711:434115:1 gene:ENSVPAG00000000593 transcript:ENSVPAT00000000593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDGHEVRSCKVADKGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQ
KIGEFCMVYSEVPNFSEPNPDYRGQQNKGAHSEQKNNSMSSNMGTGTFGPVGNGVQTGPE
ARGCQFSYAGRSNGRGPINPQLPGTADNQTVMTTISNGRDPRRAFKR
Download sequence
Identical sequences ENSVPAP00000000549 ENSVPAP00000000549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]