SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000643 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000643
Domain Number 1 Region: 57-290,357-496
Classification Level Classification E-value
Superfamily ALDH-like 5.22e-114
Family ALDH-like 0.0000000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000643   Gene: ENSVPAG00000000702   Transcript: ENSVPAT00000000702
Sequence length 500
Comment pep:novel genescaffold:vicPac1:GeneScaffold_762:403579:455367:-1 gene:ENSVPAG00000000702 transcript:ENSVPAT00000000702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSARPEIPAPLTNLKFQYTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDVD
KAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMEAMNGGKLFPNTYLM
DIGGCIKTLHYCAGWADKIQGRTIPSDGNIFTYTRSEPIGVCGQIIPWNFPLVMLLWKIA
PALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDK
VAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDKEQHEKIIDLIESG
KKEGAKLECGGGPWGNKGYFIQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRA
NNTFYGLSAGIFTKDLDRAITVSTALQAGTVWVNCYGVASAQCPFGGFKMSGNGRELGEY
GLHEYTEIKTVTIKISQKNS
Download sequence
Identical sequences ENSVPAP00000000643 ENSVPAP00000000643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]