SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000821 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000821
Domain Number 1 Region: 2454-2642
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.57e-81
Family BRCA2 helical domain 0.0000000493
Further Details:      
 
Domain Number 2 Region: 2805-2941
Classification Level Classification E-value
Superfamily BRCA2 tower domain 4.32e-58
Family BRCA2 tower domain 0.00000211
Further Details:      
 
Domain Number 3 Region: 3026-3142
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.54e-47
Family Single strand DNA-binding domain, SSB 0.0000114
Further Details:      
 
Domain Number 4 Region: 2643-2774
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-43
Family Single strand DNA-binding domain, SSB 0.00000134
Further Details:      
 
Domain Number 5 Region: 2776-2805,2942-3025
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.57e-37
Family Single strand DNA-binding domain, SSB 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000821   Gene: ENSVPAG00000000886   Transcript: ENSVPAT00000000887
Sequence length 3392
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1422:28074:80684:1 gene:ENSVPAG00000000886 transcript:ENSVPAT00000000887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIGCKERPTFFEIFRTRCNKADLGPISLNWFEELSSEAPPYNSEPSEESEYKISSYEPN
LFKTPQRKPYHHLASTPIIFKEQGPTLPLYQSPLKEQGKFRLDLGKDVTNSKHKSFCTMK
AKVDQANDVTSPPPNSCLSESPVLQYTHETPQREKSVICTLFHTPXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXRDEEASAATFPSDTTAILKGCFSNHDQSLKKN
DRFIPSGPDNENQRKAKSHELEKILEESFGNGNSCKDHFEKSMPNVLEDEVHETAADISE
EDSFPVCVSKYKRRNIRKVKTGKTRKNIFNKTKTNEYEEAEKQMTENKHSFVSEMGPNDS
DPLDSNVTNQKLFGNGADKISQEVIPSSASEWSQLTLSGLNGTQMEKTSLLHISSCDQNN
SEEDCIGTEKEFINFITSENYLPHISSLSKTVKILNEXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNFKEEEASKSGLEIQTI
CSHKEDSLCTSSVDNGSWPATTKNTSVALKNAGLISTLKKKTKRFIYAINDKTSYQGLKM
QRDQESELTHSSAQLEADHFETPLTFTNIDSGLLHSSIQKHCLQNDSEDPPLSLTSSFGT
ILRKCNNKIVSQDLDYKEAKFSKEKLESFPTETDYMSCQGEXXXXXXXXXXXXXXXXXXX
XXXXXXXXHSEDCSDTHFQSQELLHDNDNTTVLTTVFNDLSNPVVISRGKESYKMSEKIK
PKNSEAGSELTKNISLENSQEACILKEDSRKPELFSPEQYVTAASPLTKIQFNENTNLTV
FQKKQETTLISKITVNSNSEELFPDNENNFVFQITSEKSIPILENTKELHEADIICLREP
VLKNSATAARTDLGDKQAAKVSITNNFVSSNTVHDLTEKSRNSVKQQPKMTLSQDSKSDV
SLDINMKSNRNNDCMDKWARLSDSISSHSFGNGFRTASNKEIKLSEHNIKKSKMFFKDIE
EHFPTSLACIETVNTLSLKSQKKPSRPHAVDSQSMNTISGCVQNSAFICDSENSHTAPIL
SLKEDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKPSDIIQNNPFEMPENQMSV
LKTTSEEWKDVDLPLTVNVPSSSQVDSSKEFEDRVGDKQKFACLSTTNCNKSTSGNSTDK
NEVEFRGFYSARGTKLSISSEALQKAMKLFSDIENVGGTPAEVDPRIFSLSKCNNSDVSE
FKEEDYSNDKNLSEKNNKCQLVVQNNIEMTAGIFVEENTEDYKRNTENEDNECIGFVCNL
RESDGGSSSKNDTVSIHKDEDVLPCTDQHNMYLKSSRQYMMEGNSQNKEDLSDLTCLEVV
KAEETFHVNMSNKSQSTANKMRQNIKNFDTFGLSFQTASGKNISISKESLNKVVNFFDEK
CTEEEMNNFSDSSNSELLSGINTNKIDISSHEELDKVKDKILKESDSIGIENQLLTLQQG
QEYEIKKIKEPTMLGFHTASGKKVKIVKESLDKVKNLFDEKKQDNSEVTNFSHQGAKTLM
DREVCKEGFELACETVDVTAQKHEEMQNSLEEKKLVSEESAVPPWLLSDHLYRQTENLSI
TNSISLKVKVHENIEETAKSPMTCYTNQPTCSAIENSALAFYTGHGRKISVSQASLFEAK
KWLREGELDDQTEKKNSADYVGNLSCGNHSNRITTENDKNFSEEQDPTYLSNSMSNSYSC
HSDFCHSSEVFNKSEYLSKNKMGNSGIEPVVQNVKDRKNISFSEVMSTVREANTYPQAVD
ESTCVQKLVTNSSPCRNKNTATEMVISDSNNFEIEPPAFGTASDKTKVRERLTDNGGKVI
KQNTESKSDTCQTKIVTGSHKALEDSEDITFPDSPESEEHRMRSHDVSPDIQSEPILCHD
PGMSGLEKVSEIPPFHINLKTSDICKLNVEKHPRSVSSMNACGVFSTASGKSVHISDAAF
QKAKQVFSKIEDDAKQLLSKVSFKSNEEQSDKFSGENTKIHTPQNLLSSAFSGFSTASGK
QVPVSESSLCKVKGMFEEFDLIRTERSLQHSPTSRQNESKILPLSCIDKRTPEHSVSSKA
EKDYSKEFKLSNNRNVESDSSENNHSIKVFPSLIQCKQDKQQLVLGTKVLLVENFDLLGK
EQILPKNIKMEIGKAETFPNLPVKTNTEICSTNSKDLENYFETEAVDIARAFMEDGELTD
SELLSHAKHSLFTCQKNEEAVLLNSGIGKRRGGALATVGEPPTKRNLLNEFDRIIENQEK
SLKPSKSTPDGTVKDRRLFMHHTSLEPVTCGPFXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXKQKNIDERSSGDSENNGSEIHQLNKSNSNQTAAVMFTKGDKEPLDLITNLQ
NARDIQDKQIKKKQKQRIFPQPGSLYLAKTSTMPRISLKVAVEGRVPSACSHKQYMYGVS
KHCVKINSKSAESFQFHTQDYFGKEGLWAGKGIQLADGGWLIPSNDGKAGKEEFYRALCD
TPGVDPQLISRVWVYNHYRWIIWKLAAMEFAFPKEFANRCLSPERVLFQLKYRYDVEIDR
SRRSAIKKIMEKDDTAAKTLVLCVSEIASLSTDTSETPSSKTSGVDTTKAAVVELTDGWY
AIKAQTDPPLSALIKNGRLTVGQKVIIHGAELVGSPDACTPLEAPESLMLKISTNSTRPA
RWYAKLGFSPDPRPFPLPLSSLFSDGGNVGCVDIIVQRAYPIQWMEKTPSGLYIFRNERE
EEKEATKHAEAQQKKLEALFTKLQAEFEEHEDNVTERYIPPRALTRQQVRALQDGAELYE
AVKNAADPGYLEGYFSEEQLRALNNHRQMLNDKKQAQIQLEFRKAMASAEQGEQILPRDV
TTVWKLRIISYKKKEKDSVILSIWRPSSDLYSLLTEGKRYRIYHLAASKSKSKSERANIQ
LTATKKTQYQQLPASDEILFQVYQPREPLHFNKLLDPDFQPPCSEVDLIGFVVSVVKKIG
LAPLVYLSDECHNLLAIKFWIDLNEDIIKPHMLIAASNLQWRPEYKSGIPTLFAGDFSMF
SASPKEGHFQETFHKMKNTIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXMSSPSEMKYQSPLSLSKPKGKSISTPVSAQMTSKSCCKGEKEIDDPKSCK
KRRALDFLSRLPVPPPVSPICTFVSPAAQKAFQPPRSCGTRYETPIKKKELNSPQMTLLK
KFNDISLLEDDSIADEELALINTQALLSGSSGEDQRMSINESTRTAPTSAEDHLTLKRHY
TTRGIKERENSQARTEEHETNMQDTSTKKYLQ
Download sequence
Identical sequences ENSVPAP00000000821 ENSVPAP00000000821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]