SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001037 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001037
Domain Number 1 Region: 46-185
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 2.09e-46
Family Molybdopterin synthase subunit MoaE 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001037   Gene: ENSVPAG00000001123   Transcript: ENSVPAT00000001123
Sequence length 189
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2055:421672:427743:-1 gene:ENSVPAG00000001123 transcript:ENSVPAT00000001123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISSSSYNQETKLPLSPPLVEDSAFETLGKDVNEVEGKSKDIIKLTSEKLSIDEVS
RLVISPLCGAISLFVGITRNNFEGKKVISLEYEAYLPMAENEIRKICIDIRQKWPVRHIA
VFHRLGLVPVSEASIVIAVSSAHRAAALEAVSYAIDTLKARVPIWKKEMYEESSSSWKRN
KECFWATSD
Download sequence
Identical sequences ENSVPAP00000001037 ENSVPAP00000001037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]