SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001115 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001115
Domain Number 1 Region: 5-371
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 6.24e-144
Family Phosphoglycerate kinase 0.00000000000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001115   Gene: ENSVPAG00000001208   Transcript: ENSVPAT00000001208
Sequence length 371
Comment pep:known_by_projection scaffold:vicPac1:scaffold_6374:714:19275:1 gene:ENSVPAG00000001208 transcript:ENSVPAT00000001208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAIPSIKFCLDNGAKSVVL
MSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKVCADAAAGSVILLE
NLRFHVEEEGKGKDASGNKIKADPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPKKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGM
AFTFLKVLSNMEIGTSLFDEEGSKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQ
ATVASGIPAGWMGLDCGPESSKKYAEAVGRAKQIVWNGPVGVFEWEAFAQGTKALMDEVV
KATSRGCITII
Download sequence
Identical sequences ENSVPAP00000001115 ENSVPAP00000001115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]