SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001245 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001245
Domain Number 1 Region: 243-660
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 7.61e-93
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0004
Further Details:      
 
Domain Number 2 Region: 105-241
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.93e-37
Family Ferredoxin domains from multidomain proteins 0.00023
Further Details:      
 
Domain Number 3 Region: 32-104
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.56e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001245   Gene: ENSVPAG00000001346   Transcript: ENSVPAT00000001348
Sequence length 727
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3299:172130:194736:-1 gene:ENSVPAG00000001346 transcript:ENSVPAT00000001348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRIPVTRALIGLSKSPKGCARTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLTEPMVRNEKGLLTYTTWEDALSRVAGMLQSFQGSDVAAVAGGLVDAEALVALKDLLNR
VDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK
SWLHNDLQVALIGSPVDLTYRYDHLGDSPKILQDIASGSHPFSQILKEAKKPMVVLGSAA
LQRNDGAAILAAVSNIAQKIRMSSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKN
PPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTE
GRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDVE
GANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA
VEEPSVC
Download sequence
Identical sequences XP_006205272.1.17985 XP_015095534.1.17985 XP_015095535.1.17985 XP_015095536.1.17985 ENSVPAP00000001245 ENSVPAP00000001245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]