SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001300 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001300
Domain Number 1 Region: 230-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.32e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 5-52
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000393
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001300   Gene: ENSVPAG00000001407   Transcript: ENSVPAT00000001407
Sequence length 766
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_886:1262608:1334437:-1 gene:ENSVPAG00000001407 transcript:ENSVPAT00000001407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVIHCSGYLKIRQYSLDMSPFDGCYQNVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDM
KLIFLDSRVAELTGYEPQDLIEKTLYPHVHGSDTFHLHCAXXXXLVKGQVTTKYYRFLAK
HGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQISASKPAFSYASSS
TPAMTDNRKGAKSRLSSSKSKSRTSPYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGHWDEESVVSSPDPG
SASESGDRYRTEPYQSSPHEPSKIETLIRATQQMIKEEENRLQLRKGPPDQLASINGAGK
KHSLCFANYQQPPPTGEVCHGSALANTSPCDHIQQREGKMLSPHDNDYDNSPTALSRISS
PNSDRISKSSLILAKDYLHSDMSPHQTAGDHPAVSPNCFGTHRQYFDKHAYTLTGYTLEH
LYDSETIRNYSLGCNGSHFDVTSHLRMQPDPTQGHKGTSVIITNGS
Download sequence
Identical sequences ENSVPAP00000001300 ENSVPAP00000001300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]