SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001540 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001540
Domain Number 1 Region: 93-158
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000602
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.054
Further Details:      
 
Domain Number 2 Region: 207-309
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000732
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.0025
Further Details:      
 
Domain Number 3 Region: 6-61
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000929
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001540   Gene: ENSVPAG00000001665   Transcript: ENSVPAT00000001666
Sequence length 1341
Comment pep:known_by_projection scaffold:vicPac1:scaffold_2100:179968:201108:1 gene:ENSVPAG00000001665 transcript:ENSVPAT00000001666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTCSGEKWRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKA
ISNDDDVQKADVSSTGQGVIDKDSLGPLLLQALDGFLFVVNREGNIVFVSENVTQYLQYK
QEDLVNTSVYHILHEEDRKDFLKNLPKSTVNGVTWTNETQRQKSHTFSCRMLMKMPHDIM
ENINTSPEMRQRYETMQCFALSQPRAMMEEGEDLKVVNIDMNSLRSSMRPGFEDIIRRCI
QRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRH
GFVSTHFLQREQNGYRPNPNPVGQGIRPPAAGCGSAVGGMNVSPSQGLQMLSGRTYGLAD
PSPAGQMAGPRYGASGSMASVNPGPGMQSPASYQNSSYGLSMSSPPHGSPGLSSSQQSIM
ISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTGSHSFSSSSLSALQAISEGVGTSLLSTL
SSPGPKLDNSPNMNITQPGKVNSQDSRSPLGLYCDQNPVESSMCQSNSRDHHSDKESKES
VMEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTSSPLDSSCKDSAVSVTSPSGVSS
STPGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTTSCAEGNV
KQEQLSPKKKENNALLRYLLDRDDPSDTLSKELQPKVEGVDSKMSQCSSSTIPSSSQEKE
SKIKTETSEEXXXXXXXXXXXXXXXXXXXXXXXXXSTNSSNLGTKQQQMFQGANSLGLRS
PQPVQSVRPPCNRAVSLDSPVSVGSSPPVKNMSAFPMLPKQPMLGGNPRMMDGQENYGSN
MGGPNRNVTVNQTPSSGDWGLPNPKASRMEPVNSNSMGRPETEYNASLPRPPVGGSVPTM
PLRSSSIPGARPMLQQQQQQMLQLRPGEIPMGMGVSPYVQAAPSNQPGSWPDGMLSMEQG
PHGTQNRPLLRNSLDDLLGPPSNLEGQSDERALLDQLRIHHXXXXXXXXXXXXXXXXXXX
XXXXGQALEPKQDAFQGQEAAVMMEQKTALYGQTYPAQGPPMQGGFNLQGQSPSFNSMMN
QMNQQGSFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKMENPTA
GGAAVMRPMMQPQVNAQQGFLNAQMVAQRSRELLSHHFRQQRVAVMMQQTQPQTQAFSPP
PNVTASPGMDGVLPGRAMPQAPPQQFAYPPNYGMGQQPDPAFGRVSSPPNAMMSSRMGPS
QNPMMQHPQTTPMYQSSEMKGWPSGTLARNSSFSQQQFAHQGNPAAYSMVHMNGSSGPMG
QMTMNAMPMAGMPMGPDQKYC
Download sequence
Identical sequences ENSVPAP00000001540 ENSVPAP00000001540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]