SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001701 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001701
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily Ribosomal protein L20 1.44e-19
Family Ribosomal protein L20 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001701   Gene: ENSVPAG00000001846   Transcript: ENSVPAT00000001846
Sequence length 83
Comment pep:known_by_projection scaffold:vicPac1:scaffold_17203:379:1720:1 gene:ENSVPAG00000001846 transcript:ENSVPAT00000001846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWINRITAASQEHGLKYPAFIANLIKCRVELNRKVLADLAIYEPKTFKSLASLAKRRRQE
GFAAALGDGKEPEGIFSRVAHHH
Download sequence
Identical sequences ENSVPAP00000001701 ENSVPAP00000001701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]