SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001816 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000001816
Domain Number - Region: 220-300
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0213
Family PYP-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001816   Gene: ENSVPAG00000001967   Transcript: ENSVPAT00000001967
Sequence length 654
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_642:4185:183976:-1 gene:ENSVPAG00000001967 transcript:ENSVPAT00000001967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KANKNVQWDEDSVEYMLANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSD
YLHRQVLQFARQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAA
DYPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIRKQGLDRLFLECDAHMWRLGDRRIPE
GIAVDGGSDWFLLNRKFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTM
VDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTTRPTFFARKFEAVVN
QEIIGQLDYYLYGNYPAGTPGLRSYWENVYEEPDGIHSLSDVVLTLYHSFSRLGLRRAEA
SLHTEGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVF
KVASPPSDFGRLQFSEVGTEWVAKERLFRNFGGLLVPMDEPVXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXEALRLHNGPLRSAYMEQSFQSLNPVLSLPISPAQVEQAQRNAASAGAALERW
LDSLVGGMWTAMDICATGPSACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
Download sequence
Identical sequences ENSVPAP00000001816 ENSVPAP00000001816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]