SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002182 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002182
Domain Number 1 Region: 55-259,332-357,394-519,568-593
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.65e-35
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number 2 Region: 1353-1419
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000696
Family WD40-repeat 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000002182
Domain Number - Region: 995-1082,1196-1334
Classification Level Classification E-value
Superfamily ARM repeat 0.00128
Family Armadillo repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002182   Gene: ENSVPAG00000002360   Transcript: ENSVPAT00000002360
Sequence length 1420
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_464:133736:408346:1 gene:ENSVPAG00000002360 transcript:ENSVPAT00000002360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGNSLVLPIVLWGRKAPTHCISAVLLTDDGATIVTGCHDGQICLWDLSVDLEVNPRALLF
GHTASITCLSKACASSDKQYIVSASESGEMCLWDVNDGRCIEFTKLACTHTGIQFYQFSV
GNHKEGRLLCHGHYPEILVVDATSLEVLYSLVSKIAPDWISSMSIIRSHRTQEDTVVALS
VTGILKVWIVTSEISGMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVF
DAGDYSLLCSGPSENGQTWTGGDFVSADKVIIWTENGQSYIYKLPASCLPASDSFRSDVG
KAVENLIPPVQHSLLDRTDKELLICPPVTRFFYGCKEYFHKLLIQGDSSGRLNIWNISDT
PDKQEGKGGLEMTTSISLQEAFDRLNPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGRL
VCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQVSARYD
QRYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQLLVPPENCSARVQHCICSVASDHS
VGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGI
TAVEILNACDEAVPAAVDSLSHPAVNLKQAMTRRSLAALKNMAHHKLQTLATNLLASEAS
DKGNLPKYSHNSLMVQAIKTNLTDPDMHVLFFDVEALIIQLLTEEASRPNTALISPENLQ
KASGSSDKGGSFLTGKRAAVLFQQVKETIKENIKEHLLDDEEEDEEIMRQREESDPEYRA
SKSKPLTLEYNLTMDTAKLFMSCLHAWGLNEVLDEVCLDRLGMLKPHCTVSFGLLSRGGH
MSLMLPGYNQPACKLPHGKAEVGRKLPASEGVGKGTYAVSRAVTTQHLLSIISLANTLMS
MTNATFIGDHMKKGPTRPPRPSTPDLSKARGSPSTSSNIVQGQIKQVAAPVVSARSDADH
SGSDPASTPALHTCFLVNEGWSQLAAMHCVMLPDLLGLDRFRPPLLEMLARRWQDRCLEV
REAAQALLLAELRRIEQAGRKEAIDAWAPYLPQYMDHVISPGVSAEAMQTITTAPDASGP
EAKVQEEEHDLVDDDITTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKALTFLLLQPPSPKLPPHSTVRRTAID
LIGRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHALSLIA
TARPPAFITTIAKEVHRHTALAANTQSQQNMHTTTLARAKGEILRVIEILIEKMPTDVVD
LLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERNHRIAVGARHGSVALYDIR
TGKCQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQ
Download sequence
Identical sequences ENSVPAP00000002182 ENSVPAP00000002182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]