SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002417 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002417
Domain Number 1 Region: 228-480
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 2.22e-57
Family Aconitase iron-sulfur domain 0.00000000682
Further Details:      
 
Domain Number 2 Region: 579-756
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.96e-53
Family LeuD-like 0.0000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002417   Gene: ENSVPAG00000002616   Transcript: ENSVPAT00000002615
Sequence length 758
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2563:62423:81081:1 gene:ENSVPAG00000002616 transcript:ENSVPAT00000002615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPYSLLVTRLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIGVKQTGSLSG
WTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGEEGGHLTWLSACSGPDGPVVS
HSMATICNMGAEIGATTSVFPYNHRMKKYLNKTGRAXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXPHINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSA
AVAKQALAHGLKCKSQFTITPGSEQIRATIKRDGYAQILRDVGGIVLANACGPCIGQWDX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXEFDGQDTYQHPPKDSSGQRMNVSPTSQRIQILDPFDNWDGKE
MEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINVENGKANSVRNAVTQ
EFGPVPDTARYYKEHGIRWVVIGDENYGEGSSREHAALEPRHLGGRSIIPKSFARIHETN
LKKQGLLPLTFADPADYNKIHPVDKLTIQGLKDFAPGK
Download sequence
Identical sequences ENSVPAP00000002417 ENSVPAP00000002417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]