SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002510 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002510
Domain Number 1 Region: 207-346
Classification Level Classification E-value
Superfamily C-type lectin-like 7.26e-32
Family C-type lectin domain 0.00071
Further Details:      
 
Domain Number 2 Region: 353-487
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-30
Family C-type lectin domain 0.00047
Further Details:      
 
Domain Number 3 Region: 1104-1222
Classification Level Classification E-value
Superfamily C-type lectin-like 9.79e-29
Family C-type lectin domain 0.00077
Further Details:      
 
Domain Number 4 Region: 1371-1514
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-28
Family C-type lectin domain 0.0029
Further Details:      
 
Domain Number 5 Region: 941-1092
Classification Level Classification E-value
Superfamily C-type lectin-like 5.67e-28
Family C-type lectin domain 0.0029
Further Details:      
 
Domain Number 6 Region: 1531-1661
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-27
Family C-type lectin domain 0.00063
Further Details:      
 
Domain Number 7 Region: 31-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.53e-24
Family Cysteine rich domain 0.0067
Further Details:      
 
Domain Number 8 Region: 498-624
Classification Level Classification E-value
Superfamily C-type lectin-like 8.05e-19
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 9 Region: 1236-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-16
Family C-type lectin domain 0.0047
Further Details:      
 
Domain Number 10 Region: 152-208
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-16
Family Fibronectin type II module 0.0026
Further Details:      
 
Domain Number 11 Region: 799-931
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000371
Family C-type lectin domain 0.035
Further Details:      
 
Domain Number 12 Region: 708-805
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000192
Family C-type lectin domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002510   Gene: ENSVPAG00000002713   Transcript: ENSVPAT00000002713
Sequence length 1721
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1542:114993:217551:-1 gene:ENSVPAG00000002713 transcript:ENSVPAT00000002713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMRWATPRRAAKLLVLLLPCFRLVSSRSCNDSFTIVNGNTGKCIKPLNNWIVAVDCDQT
KDMFWKWVSQHRLFHLQSQKCLGLDITKSTDSLRMFSCDSNVMLWWKCEHQSLYGAAQFR
LALKDGHAIASTNSSDVWMKGGSGENLCDQPYHEIYTRGGNSYGRPCEFPFLVNGTWHHE
CVRGGDHSGPWCATTLNYEYDQKWGICLQPENGCEDNWEKDEQIGGCYQFNTQAALSWKE
AYVSCQNQGADLLSIHSAAELTYLKEKEGIARIFWIGLNQLYSARGWEWSDHKPLNFLSW
EPGMRSTPTIGGSSCARMNADSGLWQGFSCEAQLPYVCKKSLNHTAQLTDVWAYSDTRCD
AADWLPNDGFCYLLVNESDSWGKAHMKCKTFSSDLISIHSLADVEVVVTKLHNGDAKEEI
WTGLRNINTPTLFQWSDGTEVTLTYWDENEPDVPYNKTPNCVSYSGKLGQWKVQSCEEKL
KYVCKKKGQKLNDTRSDKMCPPDEDWKRHGETCYKIYKDEVPFGTNCNLTITSRFEQEYL
NDMIKKYTKSPGKYFWTGLRDTDASGEYSWASVGGVKRAVTFSNWNYLEPASPGGCVAMA
TGKSLGKWEVKDCRSFRALSICKKISEPPKPEKAAPKPEDPCPEGWHSFPSGLSCYKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQRWLWIGLNKRSPD
LQGSWQWSDHTPVSTIIMANEFQQDYNIRDCAAVKVVHRAWRRSWYFYDDREFIYLRPFA
CDTKLEWICQIPKGRTPKIPDWYNPERAGIHGPPVVIEGSEYWFVADPHLNYEEAVLYCA
SNHSSLATLTSFAGLKAIKNKIANXXXXXXXXXXXXXXXXXXXXXXXSRHPWRHFPITLG
EECLYMSAKSWFSDLNKPADCSIKLPFICEKYNVSSLEKYSPDPAAKIQCSGDWITFQNK
CFLKVKPKSVTFSEASDICHTYGGTLPSVLSQREQDFITSLFPDMEATFWIGLRWTAYEK
INKWMDNRELTYSNFHPLLIGRRLRIPISIFDEESSYHCAVMLNLQRSPFTGTWNFTSCS
EHHTVSLCQKYSEIEGRQTLQNSSETIKYQNNLYKIILKTLTWSDALRECQKENMHLVSI
TDPYQQAFLTVQAVLRNSSLWIGLSSHDDELNFGWSDGKHLQFNRWAENNEQLEDCVVLD
TDGFWKTSDCDDDQPGAICYYSGNETEKEVKPFDSVQCPSPVLNTPWIPFQNSCYNFMIT
KNRYIVTAPDEVHSKCQALNPKSRILSIRDEKENNFVLEQLLHYNYMASWVMLGIIYENN
SLMWSDKTMLSYTHWRSGRPAIKNGKFFAGLNTDGFWDIHTFNVVEDVLYFHQHSILACK
IEMVDYKEEYNTTLPQFIPYEDGIYNVIQKKVTWYEALNTCSQSGGQLASVHDQNGQLFL
EDIVKRDGFPLWVGLSSHDGRESSFEWSDGSTFDYIPWKDKKSAGNCVVLDPKGIWKHEK
CNSVMDGAICYKPTKSKEVSSRTYSSRCPAVKGSESQWIQYRDHCYTSDQALHSFLEARW
FCPELAHSATLVTIEDEDENKFVSRLIRENNNITMRVWLGLFQLSADQSWNWLDGSKVTF
AKWANKMKSGGGQCSILLASNETWIKVECSRGYGRVVCKVPLGPDYRGMGVALAVLCVLA
LISGLIWFLFRRNRFHWAGFSSVRYQHGANEDEIMLPSLHD
Download sequence
Identical sequences ENSVPAP00000002510 ENSVPAP00000002510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]