SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002525 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002525
Domain Number 1 Region: 156-322
Classification Level Classification E-value
Superfamily Carbamate kinase-like 7.85e-31
Family PyrH-like 0.0085
Further Details:      
 
Domain Number 2 Region: 332-498
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-27
Family ALDH-like 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000002525
Domain Number - Region: 39-71
Classification Level Classification E-value
Superfamily Carbamate kinase-like 0.0133
Family PyrH-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002525   Gene: ENSVPAG00000002728   Transcript: ENSVPAT00000002728
Sequence length 504
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_189:314377:342980:-1 gene:ENSVPAG00000002728 transcript:ENSVPAT00000002728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVQPSATGHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTRGDDCGL
TLGRLASIVEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILVTNLDFHDEQKRRNLNGTLHEL
LRMNIVPIVNTNDAVPPAEPNSDLQGVNVISVKDNDSLAARLAVEMKTDLLIVLSDVEGL
FDSPPGSDDAKLIDIFYPGDQQSVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGT
HPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHH
LADLLTDQRDEILLANKKDLEEAEGRLAAPLLKRLSLSTSKLNSLAIGLRQIAASSQDSV
GRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQVAALAIASGNGLLLKGGKEASH
SNRILHLLTQEALSIHGVKEAVQL
Download sequence
Identical sequences ENSVPAP00000002525 ENSVPAP00000002525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]