SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002713 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002713
Domain Number 1 Region: 3-88
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-23
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002713   Gene: ENSVPAG00000002935   Transcript: ENSVPAT00000002935
Sequence length 104
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_948:100433:103202:-1 gene:ENSVPAG00000002935 transcript:ENSVPAT00000002935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WNSLLESGAKCNAQTHGGATALHRASYCGHTDIARLLLSHGSNPRLVDDDGMTSLHKAAE
KGHTDICSLLLQHSPALKAVRDRKARLACDLLPCNSDLRDLLAS
Download sequence
Identical sequences ENSVPAP00000002713 ENSVPAP00000002713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]