SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002811 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002811
Domain Number 1 Region: 8-143
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.21e-45
Family Phosphate binding protein-like 0.0000684
Further Details:      
 
Domain Number 2 Region: 228-263
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0000000000314
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000002811
Domain Number - Region: 192-224
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0063
Family Phosphate binding protein-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002811   Gene: ENSVPAG00000003038   Transcript: ENSVPAT00000003038
Sequence length 264
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1969:587:5542:1 gene:ENSVPAG00000003038 transcript:ENSVPAT00000003038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EENSPKMRVIRVGTRKSQLARIQTDSVVATLKALYPGLQFEIIAMSTTGDKILDTALSKI
GEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRETPYDAVVFHPKFVG
KTLETLPEKSVVGTSSLRRAAQSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXILHPEECMYAVGQGALAVEVRAKDQDILDLVCVLHDPETLLRCIAER
AFLRHLEGGCSVPVAVHTAMKDGQ
Download sequence
Identical sequences ENSVPAP00000002811 ENSVPAP00000002811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]