SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002887 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002887
Domain Number 1 Region: 35-139
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.01e-41
Family Nucleoplasmin-like core domain 0.0000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002887   Gene: ENSVPAG00000003120   Transcript: ENSVPAT00000003120
Sequence length 176
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2516:375413:376930:-1 gene:ENSVPAG00000003120 transcript:ENSVPAT00000003120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGAASALAFLNQESRTRAGGIGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDA
EHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPV
TFRLKSGSGPVRITGRHQIVTISNDLSEEESEEEGSEEEEAELCPILPAKKQGGRP
Download sequence
Identical sequences XP_006210557.1.17985 XP_015100099.1.17985 ENSVPAP00000002887 ENSVPAP00000002887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]