SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002932 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002932
Domain Number 1 Region: 77-152
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 3.14e-18
Family Ribosomal protein L11, C-terminal domain 0.00064
Further Details:      
 
Domain Number 2 Region: 25-80
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.0000000000000903
Family Ribosomal L11/L12e N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002932   Gene: ENSVPAG00000003170   Transcript: ENSVPAT00000003172
Sequence length 188
Comment pep:known_by_projection scaffold:vicPac1:scaffold_9274:8121:10867:1 gene:ENSVPAG00000003170 transcript:ENSVPAT00000003172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRATRALKPEAGGVIRTIVRAQAMPGPRWVPLSDRGVSINQFCKEFNEKTKDIKEG
IPLPIKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARNTGKEVAGLVTLKHVYEIARV
KAQDDAFALQDAPLSSVVRSIIGSARSLGIRVVKDLSSEELATFQKERALFLAAQKEADL
AAQAAAKK
Download sequence
Identical sequences ENSVPAP00000002932 ENSVPAP00000002932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]