SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002969 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002969
Domain Number 1 Region: 66-218
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002969   Gene: ENSVPAG00000003210   Transcript: ENSVPAT00000003210
Sequence length 223
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2961:567478:592832:-1 gene:ENSVPAG00000003210 transcript:ENSVPAT00000003210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKIEGFLFLLLFGYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXCPYHKPLGFESGEVTPDQICSNLEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSNQ
WLQIDLKEVKVISGILTQGRCDIDEWMTKYSVQYRTDESLNWIYYKDQTGNNRVFYGNSD
RTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCT
Download sequence
Identical sequences ENSVPAP00000002969 ENSVPAP00000002969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]