SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003099 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003099
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.09e-31
Family Carbonic anhydrase 0.00000159
Further Details:      
 
Domain Number 2 Region: 176-214
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.000000484
Family Carbonic anhydrase 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003099   Gene: ENSVPAG00000003348   Transcript: ENSVPAT00000003348
Sequence length 215
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1418:325356:338610:1 gene:ENSVPAG00000003348 transcript:ENSVPAT00000003348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEHWHKDFPNAKGDRQSPVDFDTKAVAYDPSLKPLSVRYDQATSRRIVNNGHSFNVEFDD
SQDKAGKERNIKLHFVHWNTKYGDFGKAVQQPDGLAVLGIFLKIGDAKPGLQKVVDALAA
IKTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMAKF
RTLSFSAGGEPEDPMVDNWRPTQPLKGRQVRASFQ
Download sequence
Identical sequences ENSVPAP00000003099 ENSVPAP00000003099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]