SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003108 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003108
Domain Number 1 Region: 25-86
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000174
Family Nucleotide and nucleoside kinases 0.0000958
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000003108
Domain Number - Region: 164-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00498
Family Nucleotide and nucleoside kinases 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003108   Gene: ENSVPAG00000003357   Transcript: ENSVPAT00000003359
Sequence length 211
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_753:266:46255:-1 gene:ENSVPAG00000003357 transcript:ENSVPAT00000003359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGACCSARDSRSLEDSHAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLL
RAEVSSGSARGKMLSEIMEKGQLVPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLETYYKATEPVIAF
YEKRGIVRKVNAEGTVDNVFSQVCTHLDALK
Download sequence
Identical sequences ENSVPAP00000003108 ENSVPAP00000003108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]