SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003231 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003231
Domain Number 1 Region: 26-129,163-180
Classification Level Classification E-value
Superfamily FKBP-like 6.68e-30
Family FKBP immunophilin/proline isomerase 0.00047
Further Details:      
 
Domain Number 2 Region: 183-249
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000531
Family Calbindin D9K 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003231   Gene: ENSVPAG00000003488   Transcript: ENSVPAT00000003487
Sequence length 254
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_349:236100:248103:-1 gene:ENSVPAG00000003488 transcript:ENSVPAT00000003487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPGTMHFLFRLIVFFYVWGIFTAQGQKGEEEVKIEVLHRPENCSKTSKKGDLLNAHYDGF
LAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMMDMCPGEKRKVIIPSSLAYGKEG
YGMLEGIFPLHSVLASYHRAPLHVLKCMLLVINSACAEGKIPPDATLIFEIELYAVTKGP
RSIETFKQIDTDNDRQLSKTEINHYLKKEFEKDEKPRDKSYQNAVLEDIFKKNDHDGDGF
ISPKEYNVYQHDEL
Download sequence
Identical sequences ENSVPAP00000003231 ENSVPAP00000003231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]