SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003424 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003424
Domain Number 1 Region: 108-306,350-511
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.63e-75
Family YicI catalytic domain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.19e-22
Family YicI N-terminal domain-like 0.0077
Further Details:      
 
Domain Number 3 Region: 514-594
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.24e-19
Family Putative glucosidase YicI, domain 3 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003424   Gene: ENSVPAG00000003691   Transcript: ENSVPAT00000003691
Sequence length 639
Comment pep:novel genescaffold:vicPac1:GeneScaffold_29:702866:722353:1 gene:ENSVPAG00000003691 transcript:ENSVPAT00000003691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLSISTRLPSENIYGFGETEHTTFRRNISWNMWGMFARDEPPAYKKNSYGVHPYYMALE
ADGSAHGVLLLNSNAMDVAFQPTPALTYRTTGGILDFYMFLGPTPELVTQQYTELIGRPA
MIPYWALGFQLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMHRKLDFTLSSSFQN
LGLLIEQMKKNGMRFILILDPAISGNETQYLPFTRGQENNVFIKWPDNSDIVWGKVWPDL
PNVNVSGSLDQETQVKLYRAHVAFLDFLRNSTAAWWKKEIGKLYVNPREPEKSLKFDGLW
LDMNEPSNFVNGSVSGCRDETLNNPPYMPHLESRDGGLNSKTLCMESQQILPDGSPVRHY
DVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNTAAWDQLRKSII
GMMEFSLFGIPYTGANICGFFGEAEYEMCVRWMQLGAFYPFSRNHNTFGTRRQDPVAWNS
TFEMFSRKALRTRYTLLPYLYTLMHKAHVEGATVVRPLLHEFTKDDTTWDIDRQFMLGPA
ILISPVLESNTFQIHAYFPRARWYDYSTESGSESTGEWKILEAPLDHINLHIRGGYILPW
QEPAMNTQSSRQQFMGLIVALDTNGRAEGQLFWDDGQSI
Download sequence
Identical sequences ENSVPAP00000003424 ENSVPAP00000003424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]