SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003588 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003588
Domain Number 1 Region: 5-151
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.05e-35
Family Glyoxalase I (lactoylglutathione lyase) 0.000000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003588   Gene: ENSVPAG00000003863   Transcript: ENSVPAT00000003863
Sequence length 156
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2161:699524:707898:-1 gene:ENSVPAG00000003863 transcript:ENSVPAT00000003863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFLLQQTMLRIKDPKKSLDFYTRILGMTLLQKLDFPTMKFSLYFLAYEDKNDIPKDRDEK
VAWAFSRKATLELTHNWGTEDDETQSYHSGNSDPRGFGHIGIAVPDVHGACKRFEELGVK
FVKKPEDGKMKGLAFIQDPDGYWIEILNPNKMITII
Download sequence
Identical sequences ENSVPAP00000003588 ENSVPAP00000003588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]