SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003786 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003786
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 9.94e-52
Family Isochorismatase-like hydrolases 0.0000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003786   Gene: ENSVPAG00000004077   Transcript: ENSVPAT00000004077
Sequence length 195
Comment pep:known_by_projection scaffold:vicPac1:scaffold_1212:182977:196991:1 gene:ENSVPAG00000004077 transcript:ENSVPAT00000004077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTTLGNLTPSSTVFFCCDMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPKG
LGSTVQEIDLTGVKLVLPKTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALEL
VGRGIEVHIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQN
LIKASAPESGLLSKV
Download sequence
Identical sequences ENSVPAP00000003786 ENSVPAP00000003786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]