SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003787 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003787
Domain Number 1 Region: 904-1107
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000033
Family WD40-repeat 0.026
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000003787
Domain Number - Region: 432-485
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00222
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003787   Gene: ENSVPAG00000004074   Transcript: ENSVPAT00000004078
Sequence length 1252
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_47:56405:195920:-1 gene:ENSVPAG00000004074 transcript:ENSVPAT00000004078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDQEHQVELELRENNEQLIPQEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQT
RQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQL
ESAAHSRIRKERPISLGIFPLPAGDGLLTPDTQKGGETPGSEQWKFQELSQPRSHTSLKF
SSSPEAIEEDELSDVSQGGSKATTPASTAASDVAAIPTDTPLNEDNEGFVKAADTPEKSE
ISKHIEVQVAQETRNVSTGSAENEEKSEVQAIIESTPELDMDKDLSGYKGSSTPTKGIEN
KAFDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQLLETKNALNVVKN
DLIAKVDELTCEKDVLQGELEAVKQAKMKLEEKNKELEEELRKARAEAEDARQKAKEDDD
SDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSI
WQFFSRLFSSSSNTAKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSE
ETEASLASRREQKREQYRQVKAHVQKADGRVQAFGWSLPQKYKQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVGASVFYKDVAGLDIEGTKQRSASQ
SSLDKLDQELKEQQKELKNQEELSSLIWICTSTHSATKVIIIDAVQPGNILDSFTVCNSH
VLCIASVPGARETDYPAGEELSESGQVDKASLCGSMTSNSSAETDSLFGGITVVGCSAEG
VTAAATSPSTNGTSPVMEKPPXXXXXDPTNSEVDENVPTAEEATEATEGNSGSAEDTVDS
AQAGVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQLSVLPNEQDLVREEAQKMSSL
LPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRG
VDGQWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRK
ESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRI
TALMVSCNRLWVGTGNGVIISIPLTETNKTSGASGNRPGSVIRVYGDENSDKVTPGTFIP
YCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSGSSGADLTVDKAGPSPQEPGNQTPKXX
XXXXXXXXXXXXXXXDEGGESELLGEDLPLEPSVAKAERSHLIVWQVMYGSE
Download sequence
Identical sequences ENSVPAP00000003787 ENSVPAP00000003787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]