SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003830 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003830
Domain Number 1 Region: 172-370
Classification Level Classification E-value
Superfamily vWA-like 9.78e-62
Family Integrin A (or I) domain 0.00000179
Further Details:      
 
Domain Number 2 Region: 622-692
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000575
Family Integrin beta tail domain 0.0078
Further Details:      
 
Domain Number 3 Region: 579-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000781
Family Integrin beta EGF-like domains 0.0093
Further Details:      
 
Domain Number 4 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family Integrin beta EGF-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000003830
Domain Number - Region: 505-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0123
Family Integrin beta EGF-like domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003830   Gene: ENSVPAG00000004123   Transcript: ENSVPAT00000004124
Sequence length 776
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1660:18034:40928:-1 gene:ENSVPAG00000004123 transcript:ENSVPAT00000004124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESELDAKIISARDTGWGDDLSLPECQPAPCQKCILSHTSCAWCKQLXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGSFVDKTV
LPFVSTVPSKLRHPCPTRLERCQPPFSFHHVLSLTGDAKAFEQEVGRQSVSGNLDLPEGG
FDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHLDSNGLYSR
SPEFDYPSVGQVAQALSAANIQPIFAVTSATLPVYQELSKLIPKSAVGELSEDSSNVVQL
IMDAYNSLSSTVTLEHEHSLLPSGVHISYESQCGGPEKTEGEAVTRGQCNPVRFHQTXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDGHLQGVCSC
PPGRLGRLCECSEAELSSPDLESGCRAPNGTWPLCSGRGRCQCGRCTCSGQSSGRLCECD
DASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSGDTDGCVSPEGGLCSGHGRCKCN
RCQCSDGYYGTLCDQCSGCKTPCERHRDCAECGAFGTGPLATNCSMACAHANVTLALAPI
LDDGWCKERTQDNRLFFFLAEDEAEGRVVLRVKPPEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFPF
Download sequence
Identical sequences ENSVPAP00000003830 ENSVPAP00000003830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]