SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003895 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003895
Domain Number 1 Region: 29-428
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 5.1e-91
Family Iron-containing alcohol dehydrogenase 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003895   Gene: ENSVPAG00000004192   Transcript: ENSVPAT00000004192
Sequence length 433
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_665:1213109:1237279:1 gene:ENSVPAG00000004192 transcript:ENSVPAT00000004192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQCPGHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAGVTKEVGMDLQNMGAKNVCLMT
DKNLSQLPPVKTVMDSLVMASTLSFMEAIEFAKKGAFDAYVAVGGGSTMDTCKAANLYAS
SPHSHFLDYVNAPIGKGKPVTVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKTGIASR
AIKPTLGLIDPLHTLHMPERVVANSGFDVLCHALESYTALPYHMRSPCPSNPITRPAYQG
SNPISDIWAVHALQIVAKYLKRAVRNPDDLEARSNMHLASAFAGIGFGNAGVHLCHGMSY
PISGLVKKYKAKDYKVDHPLVPHGLSVVLTSPAVFTFTAQMSPERHLETAEILGADTRTA
RIPDAGPILADTLRKFLFDLDVDDGLAAIGYSKADIPALVKGTLPQERVTKLAPRPQSEE
DLSVLFEASMKLY
Download sequence
Identical sequences ENSVPAP00000003895 ENSVPAP00000003895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]