SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004310 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004310
Domain Number 1 Region: 29-79
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.000000499
Family Leucine zipper domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004310   Gene: ENSVPAG00000004644   Transcript: ENSVPAT00000004644
Sequence length 120
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_856:173428:185773:1 gene:ENSVPAG00000004644 transcript:ENSVPAT00000004644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSRER
AICALREELEMYKQWCMAMDQGKIPSEIKALLTGEEQNKSQQNSGRHVKAGKTDADSNSW
Download sequence
Identical sequences XP_006199933.1.17985 XP_010944745.1.22495 XP_010984538.1.51371 ENSVPAP00000004310 ENSVPAP00000004310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]