SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004362 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004362
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 2.09e-22
Family LEM domain 0.0000612
Further Details:      
 
Domain Number 2 Region: 106-148
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000000824
Family LEM domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004362   Gene: ENSVPAG00000004703   Transcript: ENSVPAT00000004703
Sequence length 685
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1093:292696:311589:1 gene:ENSVPAG00000004703 transcript:ENSVPAT00000004703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFLEDPSVLTKEKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSK
RPPFSSDEEREPTPVLGSGATAAGRSRSAVGRKATKKTDKPRQEDKDDLDVTELTNEELL
DQLVKYGVNPGPIVGTTRKLYEKKLLKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXDNEEGKKKEHKKVKSTRDFVPFSELPTTPSGGFFQDISFPEISTRPPLGRTEQQAAKK
VHTSKGDPPREPLIATTLPGREQLQKLASGGDLFISSKSSHNRCLEKSSSTSSQHELAAM
LVSAAASPSLIKETTSACYKDIVENIYCGEKSGIQPLSTERPHVSGQSILSSERKALEES
ERSHIISPPLAQAIRDYVNSLLAQGGVGSLPGTSNSTPLLDVENTRKRIDQSDFRETESL
SPPRKLPRISEKSVEGKDSGSYVAFQNIPGSEVMSSFAKTVVSHSLTTLGIEMSMQSQHD
KIDAPELSFPFHESILKVIEEEWQQIDKQLPSLACKYPISSREATRILSVPKVDDEILGL
ITDTSPPTGIQAVSNESCDKQLDLALCRTYEAAASALQVATHTAFVVRAMQADISQAAQI
LSSEPSRTHQALGMLSKTYDAASFLCEAAFDEVKMAAHTMGSSTLGRRYLWLKDCKINPA
SKKLAVVPFKSGMLLGREALKIIKK
Download sequence
Identical sequences ENSVPAP00000004362 ENSVPAP00000004362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]