SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004381 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004381
Domain Number 1 Region: 110-245
Classification Level Classification E-value
Superfamily dUTPase-like 2.88e-48
Family dUTPase-like 0.000000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004381   Gene: ENSVPAG00000004723   Transcript: ENSVPAT00000004723
Sequence length 250
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1602:1199507:1210333:1 gene:ENSVPAG00000004723 transcript:ENSVPAT00000004723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLCPRPKLGYHFLPSLLRVLFNGARSARPRVEAAGLSRPGQPLDRATQLAGLRPPSSA
RNLSRGCRGASNVGAGRKDMLSKAGGSPAPGTQVVSPSKRPRPAAEEGGIRLRFVRLSEH
ATAPTKGSGRAAGYDLYSAYDYTVPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKHFI
DVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERG
SGGFGSTGKN
Download sequence
Identical sequences ENSVPAP00000004381 ENSVPAP00000004381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]