SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004730 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004730
Domain Number 1 Region: 103-178,211-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000285
Family C-terminal domain of adrenodoxin reductase-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004730   Gene: ENSVPAG00000005102   Transcript: ENSVPAT00000005102
Sequence length 483
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2450:93796:102278:1 gene:ENSVPAG00000005102 transcript:ENSVPAT00000005102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGPSGICLSYMLSGYRPYLSSEAIHPNAILHGKLEEARQLSIVDQDLEYLSEGLEGRSSN
PVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHLVLGKGPPGGAWHNMEGSMLTISF
GNWMELPGLKFKDWVSSKRRNIKGDRVMPEEIARYYKHYVKVMGLQKNFRENTYITSVSR
LYRDQIDNDGQDRDISTQPLQIEKSKFIKRNWEIRGYQRTADGSPVPFCLFAENVALATG
SLDSPGRLEIEGEDFPFVFHSMPEFGAAISKGKLRGKVDPVLIVGSGLTAADAVLCAYNN
NVPVIHVFRKRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSLHSRLLPDYTSFPEHHV
LSFKSDLKCILQSISGLKKIFKLSAAVVLIGSHPNLSFLKEQGCYLGHNSSQPITCKGNP
VEIDAYTYECVKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKQHLFVERGRGD
GIA
Download sequence
Identical sequences ENSVPAP00000004730 ENSVPAP00000004730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]