SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004899 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004899
Domain Number 1 Region: 97-311
Classification Level Classification E-value
Superfamily FKBP-like 6.48e-30
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004899   Gene: ENSVPAG00000005278   Transcript: ENSVPAT00000005278
Sequence length 1240
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1558:43104:105482:-1 gene:ENSVPAG00000005278 transcript:ENSVPAT00000005278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVGGERPWKSRPPRSGARASAMFGAGDEDDTDFLSPSGGARLASLFVLDQAAAGHGNEFF
QYTAPKQPKKGQGTAPTGNQVTPKTAPTTAGTSTVLVATAVHAYRYTNGQYVKQGKFGAA
VLENHTSREYRILLYISQQQPVTVARIHLNFELMVRPNNYSTFYDDQKQNWSIMFESEKA
AVEFNKQVCIAKCNSTSSLDSVLSQDLIVAEGPAVEVGDSLEVAYTSWLFQNHVLGQVFD
STANKDKLLRLKLGSGKVIKGWEDGMVGMKKGGKRLLIIPPACAVGSEGVIGWTQSTDSI
LVFEVEIRRVKFARDSGSDAHSVSSRDSAAPSPIPGADSLSADPVVSPSTSVPFKPGESA
LRSKSNSLSDQLTINTSPDTVKAKLISRMAKMGQPMLPILPPQLDSNDSEIEXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXPYAGMQAYAYPQASAVTSQLQPVRPLYPAPLSQSPHFQGSGDVASFLMTEARQHNTEI
RMAVSKVADKMDHLMTKVEELQKHSAGNSLLMPSMSVTMETSMIMSNIQRIIQENERLKQ
EILEKSSRIEEQNDKISELIERNQRYVEQSNLMMERRNNSLQTATENTQARVLHAEQEKA
KVTEELAAATAQVSHLQLKMTAHQKKETELQVQLTESMKEADLLRSQLTKLQTELSELQE
TAEQAESKFKSEKQSRRQLELRVTSLEEELTDLRAEKESLEKNLSERKKKSAQERCQAEE
EIDEIRKSHQEELDKLRQLLKKARVSTDQAAAEQLSLVQAELQTQWEAKCEHLLASAKDE
HLQQYQEVCAQRDASQQKLLQLEKKXXXXXXXXXALTEKNAQSFMDESKSQLFTVEAASA
DPSEKVKKIMNQVFQSLRGEFDLEESYNGRTILGTIMNTIKMVTLELLNQHEREKGGSSD
EEEEEKGGERPQTPSQELPVLASSGRSQTPLNGERQELPTVPPEHVVQEAVPLPPQALPS
PQDDVQGRERDSSEAEVLSEAKDDSFPSGLAGAPXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAAPRTSPWYQSSXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSMKGRPPPTPLFGDDDDDDDTDWLG
Download sequence
Identical sequences ENSVPAP00000004899 ENSVPAP00000004899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]