SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004922 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004922
Domain Number 1 Region: 163-250
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.84e-28
Family Carbonic anhydrase 0.00047
Further Details:      
 
Domain Number 2 Region: 3-60
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.00000000000864
Family Carbonic anhydrase 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004922   Gene: ENSVPAG00000005302   Transcript: ENSVPAT00000005302
Sequence length 284
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1754:559530:588174:1 gene:ENSVPAG00000005302 transcript:ENSVPAT00000005302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTLDEAHWQQYPDCGGMRQSPIDVQRKKVRYNPSLRPLNLTGYEGHSGEFSMTNNGHTXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKTVLNGLDIQNMLPKD
LHSYYSYWGSLTTPPCTENVHWFVLADTIKLSRAQILKLENSLLDSENKTLQNDYRRTQP
LNHRVVEASFMSLPHQRKGYPCMRNCPKVEHSSCHLLDSGSFQV
Download sequence
Identical sequences ENSVPAP00000004922 ENSVPAP00000004922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]