SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005035 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005035
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.01e-90
Family Carbonic anhydrase 0.000000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005035   Gene: ENSVPAG00000005421   Transcript: ENSVPAT00000005420
Sequence length 314
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2986:257679:261138:1 gene:ENSVPAG00000005421 transcript:ENSVPAT00000005420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHWTYEGPHGQDHWPASYPECGSNAQSPINIQTDSVTFDPELLVLQPHGYEQPGTEPLDL
HNNGHTVQLSLPPTLYLEGLPRKYVAAQLHLHWGQRGSPRGSEHQINGEATAAELHIVHY
DSDSYNSLSEAAQRPQGLAVLGILIEVGETKNPAYEHILSHLHEIRHKDQKTSVPPFNVR
ELLPPLLAQFFRYNGSLTTPPCYQSVLWTVFNRKAQISIGQLEKLQETLFSTEEEPSKLL
VRNYRAPQPLNQRAVFASFIQVGSLYTTGEMLSLGVGILVGCLCLLLALYFIVRKIRKRL
GNRKSVVFSARAEA
Download sequence
Identical sequences ENSVPAP00000005035 ENSVPAP00000005035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]