SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005054 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005054
Domain Number 1 Region: 418-520
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 234-288,315-330,358-376
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-16
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 152-235
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 591-790
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0000000259
Family Tetraviridae-like VP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005054   Gene: ENSVPAG00000005439   Transcript: ENSVPAT00000005439
Sequence length 844
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2986:659843:711740:-1 gene:ENSVPAG00000005439 transcript:ENSVPAT00000005439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDSAVAVAAVGRRVWGVALPSPSPVRWRRLLPWGWCSGGGICGHGGDYCPRXXXXXXXXX
XXXXXXXXXXITSDVPSLGPAIASGNPGSGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKF
LRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTC
SALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIV
SCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDL
KTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNSSVDPVSMNRLSFVRNRCRNGLGSVKDG
EPHFVVVHCTGYIKAWPPADDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFI
SRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLS
VMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQL
GPAANLSLEMGSGQMAPRQQQQQTELDVVPGRDGLAGYNHSQVSVQPVTTTGPEHSKPLE
KSEGLFAQDRDPRFSIYSSIYADQSKGISSSTVPATQQLFSQGSSFPPTPRPAENFRNSG
LAPPVTIVQPSASAGQMLAQISRHSNPTQGAAPAWTPSTRPGFSAQQVATQATAKTRSSQ
FGVGSFQTPSSFSPMSLPGASTASPGAAAYPSLASRGSNFTPETGQTAGQFQTRTAEGVG
VWPQWQGQQPHHRSSSNEQHVQQPAAPQPGQPEVFQXXXXXXXXXXXXXXXEFPDLTMFP
SFSE
Download sequence
Identical sequences ENSVPAP00000005054 ENSVPAP00000005054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]