SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005162 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005162
Domain Number 1 Region: 258-363
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.33e-20
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00000173
Further Details:      
 
Domain Number 2 Region: 914-960
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000235
Family Nuclear receptor coactivator interlocking domain 0.0001
Further Details:      
 
Domain Number 3 Region: 118-182
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000314
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 4 Region: 27-88
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000929
Family HLH, helix-loop-helix DNA-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005162   Gene: ENSVPAG00000005553   Transcript: ENSVPAT00000005554
Sequence length 1434
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1066:764507:854974:1 gene:ENSVPAG00000005553 transcript:ENSVPAT00000005554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGDSSSDPANPDSHKRKGSPCDTLATEKRRREQENKYLEELAELLSANISDIDSLSV
KPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEALDG
FFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVP
WPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQSC
LICIARRLPRPLAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQP
QGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIH
IIDREHSGLSPQEDTNSGMSIPRVNPSVNPNISPAHGVARSSALPPSNSNMVSTRVNRQQ
SSDLHSSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPSLLNNFLEGTGIFHA
QFMSPRQVSSGLATRPRMPNNSFPPNIPTLTSPVSMTSTACNNSNRSYSNIPVTPLQSMN
EGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDNSSNDG
KPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSCTGTSN
SASANSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVSVTGQV
QGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVKKEQMDSCNT
NPTPMTKSAPEDIKLESQSQFTADLDQFDQLLPTLEKAAQLPGLCETERMDGAVTSVTVK
SEILPASLQSTTARPTSRLNRLPELELEAIDNQFGQPGTGDQVPWANNTVTAVNQTKPED
QCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGL
DVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLSSPFQGMIRQKPSLGTMPVQVT
PPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSFGNNLPP
SSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASPSPFSQLAANPEASLANRNSMVN
RGMTGNMGQFGTGINPQMQQNVFQYPGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXINDPALRHTGLYCNQLSSSDLLKTEADGTQQV
QQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLTE
Download sequence
Identical sequences ENSVPAP00000005162 ENSVPAP00000005162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]