SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005296 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005296
Domain Number 1 Region: 186-291
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 9.55e-36
Family eIF-2-alpha, C-terminal domain 0.00000152
Further Details:      
 
Domain Number 2 Region: 104-182
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 5.76e-25
Family eIF2alpha middle domain-like 0.00000736
Further Details:      
 
Domain Number 3 Region: 11-90
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000372
Family Cold shock DNA-binding domain-like 0.0000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005296   Gene: ENSVPAG00000005698   Transcript: ENSVPAT00000005698
Sequence length 303
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2781:564149:575801:1 gene:ENSVPAG00000005698 transcript:ENSVPAT00000005698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLRIGRNEXXXXXXXXXXXXYIDLSKRRVSPEGXXXXXXXXXXXXXVYSILRHVAEVLEY
TKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNIN
RRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTTT
LERTEGLSVLNQAMAVIKEKIEPKVVTDTDETELARQLERLERENAEVDGDDDAEEMEAK
AED
Download sequence
Identical sequences ENSVPAP00000005296 ENSVPAP00000005296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]