SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005401 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005401
Domain Number 1 Region: 31-141
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.92e-36
Family Frataxin-like 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005401   Gene: ENSVPAG00000005818   Transcript: ENSVPAT00000005816
Sequence length 155
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2455:1090:15904:1 gene:ENSVPAG00000005818 transcript:ENSVPAT00000005816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVGLRCLNQILNVKKQSVCLMNLRTAGTVSSPGSLDDTTYERLAEETLDSLAEFFEELAD
KPYTLEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSGPKRYDWTGKNWVYS
HDGVSLHELLARELTQALKTKLDLSSLAYSGKDTC
Download sequence
Identical sequences ENSVPAP00000005401 ENSVPAP00000005401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]