SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005651 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005651
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.2e-72
Family Tubulin, GTPase domain 0.00000000384
Further Details:      
 
Domain Number 2 Region: 242-281
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 0.0000336
Family Tubulin, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005651   Gene: ENSVPAG00000006094   Transcript: ENSVPAT00000006093
Sequence length 282
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3464:102389:105803:-1 gene:ENSVPAG00000006094 transcript:ENSVPAT00000006093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKH
VPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDR
IRKLXDQHTFLIFHNFDRGTGSGFTSQLVEQLCVDYGKKCKLKFAIHPAPQLSTAVVELY
NSILANHTAPEHDCDFMEDKEAYDLHHCNLDTEHPTYLNFNQLTGQIVSCITASLHFDDA
LNVDLEKFQTNLVPGSHIHIPPVTYISIISVKNASHKQLSVP
Download sequence
Identical sequences ENSVPAP00000005651 ENSVPAP00000005651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]