SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005790 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005790
Domain Number 1 Region: 333-447,569-684
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-53
Family Phosphate binding protein-like 0.00000000921
Further Details:      
 
Domain Number 2 Region: 55-318
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2e-38
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 3 Region: 471-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000667
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005790   Gene: ENSVPAG00000006246   Transcript: ENSVPAT00000006244
Sequence length 804
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1199:394835:675046:1 gene:ENSVPAG00000006246 transcript:ENSVPAT00000006244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCSQFSRGVYAIFGFYDQMSMNTLTSLCGAXXXXXXXXXXXXXXXXXXXIQMRPLKGAIL
SLLGHYKWEKFVYLYDTERGFSILQAIMEAAVQNNWQVTARSVGNIKDVQEFRRIIEEMD
RRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDILLERVMHGGANITGF
QIVNNENPMVQQFIQRWVRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVD
VSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKV
TGSRKAGYWNEYERFVPFSDQQISNDSASAENRTIVVTTILESPYVMYKKNHEQLEGNER
YEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLT
ITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVL
FLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSG
RIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEF
FRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPC
DTMKVGGNLDSKGYGVATPKGSALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYKSRAESKRMKLTKNTQNFKPAP
ATNTQNYATYREGYNVYGTESVKI
Download sequence
Identical sequences ENSVPAP00000005790 ENSVPAP00000005790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]