SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005823 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005823
Domain Number 1 Region: 7-337
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-110
Family ALDH-like 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005823   Gene: ENSVPAG00000006278   Transcript: ENSVPAT00000006277
Sequence length 337
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_890:1603526:1618134:-1 gene:ENSVPAG00000006278 transcript:ENSVPAT00000006277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRALLTLENFIGGKFLPCNSYLDSYDPSTGEVYCRVPDSGKEEIEAAVEAARAAFPG
WSSRSPQERSQVLHQLADLLEQSLEELAQAESKDQGKTITLARTMDIPRSVQNFRFFASS
ILHHTSECTQMDHLGCLHYTVRAPVGIAGLISPWNLPLYLLTWKMAPAIAAGNTVIAKPS
ELTSVTAWMMCRLLEKAGVPAGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPALIFEDANLEECVPTTVRSSFANQGEICLCTSRIFVQKSIY
NEFLKRFVEATRMWKVGIPSDPSANMGALISKAHLEK
Download sequence
Identical sequences ENSVPAP00000005823 ENSVPAP00000005823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]