SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006183 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006183
Domain Number 1 Region: 2-285
Classification Level Classification E-value
Superfamily ALDH-like 1.19e-112
Family ALDH-like 0.000000000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006183   Gene: ENSVPAG00000006657   Transcript: ENSVPAT00000006657
Sequence length 290
Comment pep:novel scaffold:vicPac1:scaffold_6355:895:18802:1 gene:ENSVPAG00000006657 transcript:ENSVPAT00000006657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKVIKEAAGKSNLKRVTLELG
GKSPCIVFADADLDNAIEFAHHGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYV
LGNPLTPGVSQGPQINKEQYEKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSNVT
DEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLAAGVFTKDLDKAITVSNALQAGV
VWVNCYSMLPTQCPFGGFKMSGNGRELGEYGLHEYTEIKTVTIKISQKNS
Download sequence
Identical sequences ENSVPAP00000006183 ENSVPAP00000006183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]