SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006233 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006233
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.13e-62
Family Alanine racemase-like, N-terminal domain 0.000000124
Further Details:      
 
Domain Number 2 Region: 248-416
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 6.91e-34
Family Eukaryotic ODC-like 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006233   Gene: ENSVPAG00000006712   Transcript: ENSVPAT00000006711
Sequence length 448
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2122:73584:82519:-1 gene:ENSVPAG00000006712 transcript:ENSVPAT00000006711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVDLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNIVA
QIKPFYTVKCNSTPAVLEILAALGTGFACSSKTEMALVQELGVSPENIIYISPCKQVSQI
KYAAKVGVTIMTCDNEVELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHL
LECAKELGVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEFGFTMNILDIGGGFTG
TEFQLEEVNHVISPLLDVYFPEGSGIKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSS
GVGKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDE
LDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSYSDWYEMQDSGI
TSDTMMKSFFFVPSCIQLSQEDSFSTEA
Download sequence
Identical sequences ENSVPAP00000006233 ENSVPAP00000006233 NP_001278686.1.17985 NP_001288727.1.17985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]