SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006368 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006368
Domain Number 1 Region: 36-93
Classification Level Classification E-value
Superfamily Kringle-like 2.4e-19
Family Fibronectin type II module 0.0035
Further Details:      
 
Domain Number 2 Region: 154-199
Classification Level Classification E-value
Superfamily Kringle-like 1.83e-16
Family Fibronectin type II module 0.0023
Further Details:      
 
Domain Number 3 Region: 4-47
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000123
Family Fibronectin type II module 0.0029
Further Details:      
 
Domain Number 4 Region: 95-145
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000148
Family Fibronectin type II module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006368   Gene: ENSVPAG00000006852   Transcript: ENSVPAT00000006852
Sequence length 199
Comment pep:known_by_projection scaffold:vicPac1:scaffold_7404:765:8902:-1 gene:ENSVPAG00000006852 transcript:ENSVPAT00000006852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKDSCVFPFTYKGSTYFSCTRANSFYPWCATRTVYDGKWKYCMVEDYPRCIFPFIYRGRS
YQKCITEGSIFGKLWCSVTSSFDEKQQWKYCETNDYGGNSFSKPCIFPSIYRNNVISECI
EDESNKLWCPTTENMDNDGKWSLCADTRVSSLVPGFPCHFPFNYKNKNYFNCTRKGSEEN
LLWCATSYNYDQDHTWVYC
Download sequence
Identical sequences ENSVPAP00000006368 ENSVPAP00000006368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]