SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006514 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000006514
Domain Number - Region: 134-186
Classification Level Classification E-value
Superfamily NTF2-like 0.014
Family TIM44-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006514   Gene: ENSVPAG00000007005   Transcript: ENSVPAT00000007005
Sequence length 291
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1055:870284:878211:1 gene:ENSVPAG00000007005 transcript:ENSVPAT00000007005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAVCILPRFLLSRPLFGLAARLRTPGSAELRPPLPGLCCFCCRRLGSRAALFPRVSWA
SAALTLPVRGPGRPLLNPPGLIAALPAFPSCLRRTYSTEEQPQQRQKTKMIILGFSNPIN
WVRTRIYAFLIWAYFDQEFSIAEFSEGAKQAFAYVSRLLSQCKFDLLEELVAKEALQVLK
EKVTSLPDNHKNALAADIDEIVYTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETI
SGASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHPKLIE
Download sequence
Identical sequences XP_006205226.1.17985 ENSVPAP00000006514 ENSVPAP00000006514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]