SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006535 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006535
Domain Number 1 Region: 192-255
Classification Level Classification E-value
Superfamily RILP dimerisation region 2.48e-19
Family RILP dimerisation region 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006535   Gene: ENSVPAG00000007026   Transcript: ENSVPAT00000007026
Sequence length 283
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_167:289002:331105:-1 gene:ENSVPAG00000007026 transcript:ENSVPAT00000007026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVSFSEEEFQKHEXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQQQQTRLMKINHDLRHRVTVVEAQGKALI
EQKVELEADLQTKEQEMGSLRAELGKLRERLQGGLSQNGEEEPEQEPGGDECVSEVEKVA
MDLKVPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENRIPQPPPVTHP
RTSPQPESGIKRLIFTAIMPMVAAGLIIDDPTLQPVRRLVSLV
Download sequence
Identical sequences ENSVPAP00000006535 ENSVPAP00000006535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]